PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G67110.2
Common NameALC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bHLH
Protein Properties Length: 150aa    MW: 16469.6 Da    PI: 10.2793
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G67110.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.81e-0997127435
                  HHHHHHHHHHHHHHHHHHHHHCTSCCC...TT CS
          HLH   4 ahnerErrRRdriNsafeeLrellPkaskaps 35 
                   hn  E++RR++iN+++  L++l+P++ +  +
  AT5G67110.2  97 FHNLSEKKRRSKINEKMKALQKLIPNS-NKVN 127
                  6*************************6.2344 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.95993142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.46E-996127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.6E-797125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.9E-998127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.15E-798137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010047Biological Processfruit dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MGDSDVGDRL PPPSSSDELS SFLRQILSRT PTAQPSSPPK STNVSSAETF FPSVSGGAVS  60
SVGYGVSETG QDKYAFEHKR SGAKQRNSLK RNIDAQFHNL SEKKRRSKIN EKMKALQKLI  120
PNSNKVNQSL FESEIVRNIV LIDPLSFVCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102107KKRRSK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.288250.0flower| inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247035_at1e-144
Expression AtlasAT5G67110-
AtGenExpressAT5G67110-
ATTED-IIAT5G67110-
Functional Description ? help Back to Top
Source Description
TAIRencodes a myc/bHLH transcription factor-like protein. Gene product is involved in fruit dehiscence. Mutant siliques fail to dehisce.
Function -- GeneRIF ? help Back to Top
  1. Over-expression of ALCATRAZ can partially compensate for a loss of SPATULA function, and over-expression of SPATULA can fully compensate for loss of ALCATRAZ function.
    [PMID: 21801252]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G67110.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G42830 (A), AT3G58780 (A), AT5G02030 (R), AT5G60910 (R)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G67110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0289460.0BT028946.1 Arabidopsis thaliana At5g67110 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001078810.11e-106transcription factor ALC
SwissprotQ9FHA21e-88ALC_ARATH; Transcription factor ALC
TrEMBLQ8LFU96e-86Q8LFU9_ARATH; Putative uncharacterized protein
STRINGAT5G67110.13e-86(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rajani S,Sundaresan V
    The Arabidopsis myc/bHLH gene ALCATRAZ enables cell separation in fruit dehiscence.
    Curr. Biol., 2001. 11(24): p. 1914-22
    [PMID:11747817]
  3. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  4. Robles P,Pelaz S
    Flower and fruit development in Arabidopsis thaliana.
    Int. J. Dev. Biol., 2005. 49(5-6): p. 633-43
    [PMID:16096970]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Mitsuda N,Ohme-Takagi M
    NAC transcription factors NST1 and NST3 regulate pod shattering in a partially redundant manner by promoting secondary wall formation after the establishment of tissue identity.
    Plant J., 2008. 56(5): p. 768-78
    [PMID:18657234]
  7. Wang F,Shi DQ,Liu J,Yang WC
    Novel nuclear protein ALC-INTERACTING PROTEIN1 is expressed in vascular and mesocarp cells in Arabidopsis.
    J Integr Plant Biol, 2008. 50(7): p. 918-27
    [PMID:18713402]
  8. Mummenhoff K,Polster A,M
    Lepidium as a model system for studying the evolution of fruit development in Brassicaceae.
    J. Exp. Bot., 2009. 60(5): p. 1503-13
    [PMID:19052256]
  9. Hua S, et al.
    Sequence, expression divergence, and complementation of homologous ALCATRAZ loci in Brassica napus.
    Planta, 2009. 230(3): p. 493-503
    [PMID:19504267]
  10. Irish VF
    The flowering of Arabidopsis flower development.
    Plant J., 2010. 61(6): p. 1014-28
    [PMID:20409275]
  11. Arnaud N, et al.
    Gibberellins control fruit patterning in Arabidopsis thaliana.
    Genes Dev., 2010. 24(19): p. 2127-32
    [PMID:20889713]
  12. Moran CN,Halliday KJ
    Fruit development: new directions for an old pathway.
    Curr. Biol., 2010. 20(24): p. R1081-3
    [PMID:21172630]
  13. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  14. Groszmann M,Paicu T,Alvarez JP,Swain SM,Smyth DR
    SPATULA and ALCATRAZ, are partially redundant, functionally diverging bHLH genes required for Arabidopsis gynoecium and fruit development.
    Plant J., 2011. 68(5): p. 816-29
    [PMID:21801252]
  15. Avino M,Kramer EM,Donohue K,Hammel AJ,Hall JC
    Understanding the basis of a novel fruit type in Brassicaceae: conservation and deviation in expression patterns of six genes.
    Evodevo, 2012. 3(1): p. 20
    [PMID:22943452]
  16. Lenser T,Thei
    Conservation of fruit dehiscence pathways between Lepidium campestre and Arabidopsis thaliana sheds light on the regulation of INDEHISCENT.
    Plant J., 2013. 76(4): p. 545-56
    [PMID:24004048]
  17. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]